Name | TAFA3/FAM19A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59502 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to FAM19A3(family with sequence similarity 19 (chemokine (C-C motif)-like), member A3) The peptide sequence was selected from the middle region of FAM19A3. Peptide sequence FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAA |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | FAM19A3 |
Supplier Page | Shop |