TAFA3/FAM19A3 Antibody

Name TAFA3/FAM19A3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59502
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to FAM19A3(family with sequence similarity 19 (chemokine (C-C motif)-like), member A3) The peptide sequence was selected from the middle region of FAM19A3. Peptide sequence FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAA
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FAM19A3
Supplier Page Shop

Product images