SLC25A36 Antibody

Name SLC25A36 Antibody
Supplier Novus Biologicals
Catalog NBP1-59497
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC25A36(solute carrier family 25, member 36) The peptide sequence was selected from the N terminal of SLC25A36. Peptide sequence SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC25A36
Conjugate Unconjugated
Supplier Page Shop

Product images