PMCA4 Antibody

Name PMCA4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59481
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ATP2B4(ATPase, Ca++ transporting, plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATP2B4
Conjugate Unconjugated
Supplier Page Shop

Product images