Name | PMCA4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59481 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ATP2B4(ATPase, Ca++ transporting, plasma membrane 4) The peptide sequence was selected from the middle region of ATP2B4. Peptide sequence FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ATP2B4 |
Conjugate | Unconjugated |
Supplier Page | Shop |