PAQR6 Antibody

Name PAQR6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59477
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PAQR6
Conjugate Unconjugated
Supplier Page Shop

Product images