PAQR6 Antibody
| Name | PAQR6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59477 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PAQR6(progestin and adipoQ receptor family member VI) The peptide sequence was selected from the N terminal of PAQR6. Peptide sequence PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PAQR6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: PAQR6 Antibody [NBP1-59477] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7447_PAQR6-Antibody-Western-Blot-NBP1-59477-img0002.jpg)
![Western Blot: PAQR6 Antibody [NBP1-59477] - Jurkat, Antibody Dilution: 1.0 ug/ml PAQR6 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7448_PAQR6%2520Antibody-Western%2520Blot-NBP1-59477-img0003.jpg)