SLC16A12 Antibody

Name SLC16A12 Antibody
Supplier Novus Biologicals
Catalog NBP1-59530
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC16A12(solute carrier family 16, member 12 (monocarboxylic acid transporter 12)) The peptide sequence was selected from the N terminal of SLC16A12. Peptide sequence WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDY
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC16A12
Conjugate Unconjugated
Supplier Page Shop

Product images