CutA Antibody

Name CutA Antibody
Supplier Novus Biologicals
Catalog NBP1-59527
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CUTA(cutA divalent cation tolerance homolog (E. coli)) The peptide sequence was selected from the middle region of CUTA. Peptide sequence AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CUTA
Conjugate Unconjugated
Supplier Page Shop

Product images