ACPL2 Antibody

Name ACPL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59508
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACPL2(acid phosphatase-like 2) The peptide sequence was selected from the middle region of ACPL2. Peptide sequence SFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLKKHKLLP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PXYLP1
Conjugate Unconjugated
Supplier Page Shop

Product images