SEMA3D Antibody

Name SEMA3D Antibody
Supplier Novus Biologicals
Catalog NBP1-59505
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SEMA3D(sema domain, immunoglobulin domain, short basic domain, secreted, 3D) The peptide sequence was selected from the middle region of SEMA3D. Peptide sequence LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SEMA3D
Conjugate Unconjugated
Supplier Page Shop

Product images