LRRN3/NLRR-3 Antibody

Name LRRN3/NLRR-3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59504
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRN3(leucine rich repeat neuronal 3) The peptide sequence was selected from the N terminal of LRRN3. Peptide sequence ELYINHNLLSTISPGAFIGLHNLLRLHLNSNRLQMINSKWFDALPNLEIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRN3
Conjugate Unconjugated
Supplier Page Shop

Product images