DIRC2 Antibody
| Name | DIRC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59634 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Horse, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to DIRC2(disrupted in renal carcinoma 2) The peptide sequence was selected from the middle region of DIRC2. Peptide sequence AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DIRC2 |
| Supplier Page | Shop |
Product images
![Western Blot: DIRC2 Antibody [NBP1-59634] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9211_DIRC2%2520Antibody-Western%2520Blot-NBP1-59634-img0002.jpg)
Western Blot: DIRC2 Antibody [NBP1-59634] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.