MFSD1 Antibody
| Name | MFSD1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59624 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MFSD1(major facilitator superfamily domain containing 1) The peptide sequence was selected from the middle region of MFSD1. Peptide sequence RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MFSD1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: MFSD1 Antibody [NBP1-59624] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24612_MFSD1-Antibody-Western-Blot-NBP1-59624-img0003.jpg)
![Western Blot: MFSD1 Antibody [NBP1-59624] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24613_MFSD1-Antibody-Western-Blot-NBP1-59624-img0002.jpg)
![Western Blot: MFSD1 Antibody [NBP1-59624] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24614_MFSD1%2520Antibody-Western%2520Blot-NBP1-59624-img0004.jpg)