AFG3L2 Antibody

Name AFG3L2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59572
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB ELISA
Species Reactivities Human, Mouse, Rat, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to AFG3L2 (AFG3 ATPase family gene 3-like 2 (yeast) The peptide sequence was selected from the middle region of AFG3L2. Peptide sequence VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene AFG3L2
Supplier Page Shop

Product images