Name | AFG3L2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59572 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB ELISA |
Species Reactivities | Human, Mouse, Rat, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to AFG3L2 (AFG3 ATPase family gene 3-like 2 (yeast) The peptide sequence was selected from the middle region of AFG3L2. Peptide sequence VNFLKNPKQYQDLGAKIPKGAILTGPPGTGKTLLAKATAGEANVPFITVS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | AFG3L2 |
Supplier Page | Shop |