ROBO2 Antibody

Name ROBO2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59546
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ROBO2(roundabout, axon guidance receptor, homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of ROBO2. Peptide sequence PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ROBO2
Conjugate Unconjugated
Supplier Page Shop

Product images