SLC25A46 Antibody
| Name | SLC25A46 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59604 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC25A46(solute carrier family 25, member 46) The peptide sequence was selected from the C terminal of SLC25A46. Peptide sequence LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC25A46 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC25A46 Antibody [NBP1-59604] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16899_SLC25A46-Antibody-Western-Blot-NBP1-59604-img0002.jpg)
Western Blot: SLC25A46 Antibody [NBP1-59604] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.