SLC39A8/ZIP8 Antibody
| Name | SLC39A8/ZIP8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59601 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to SLC39A8(solute carrier family 39 (zinc transporter), member 8) The peptide sequence was selected from the N terminal of SLC39A8. Peptide sequence QLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC39A8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC39A8/ZIP8 Antibody [NBP1-59601] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19468_SLC39A8-ZIP8-Antibody-Western-Blot-NBP1-59601-img0001.jpg)
![Immunohistochemistry-Paraffin: SLC39A8/ZIP8 Antibody [NBP1-59601] - Human Pancreas (Cancer) & rat pancreas, 6.6 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/19469_SLC39A8-ZIP8-Antibody-Immunohistochemistry-Paraffin-NBP1-59601-img0002.jpg)