SLC25A32 Antibody

Name SLC25A32 Antibody
Supplier Novus Biologicals
Catalog NBP1-59583
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the N terminal of SLC25A32. Peptide sequence VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC25A32
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.