SLC25A21 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59581
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC25A21(solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21) The peptide sequence was selected from the N terminal of SLC25A21. Peptide sequence FYKGILPPILAETPKRAVKFFTFEQYKKLLGY
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC25A21
• Conjugate: Unconjugated