Name | SLC25A20 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59574 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | Synthetic peptides corresponding to SLC25A20(solute carrier family 25 (carnitine/acylcarnitine translocase), member 20) The peptide sequence was selected from the C terminal of SLC25A20 (NP_000378). Peptide sequence GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFR |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC25A20 |
Conjugate | Unconjugated |
Supplier Page | Shop |