SLC25A20 Antibody

Name SLC25A20 Antibody
Supplier Novus Biologicals
Catalog NBP1-59574
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen Synthetic peptides corresponding to SLC25A20(solute carrier family 25 (carnitine/acylcarnitine translocase), member 20) The peptide sequence was selected from the C terminal of SLC25A20 (NP_000378). Peptide sequence GGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFR
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC25A20
Conjugate Unconjugated
Supplier Page Shop

Product images