COX18 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59616
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to COX18(COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of COX18. Peptide sequence LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: COX18
• Conjugate: Unconjugated

Product images

Western Blot: COX18 Antibody [NBP1-59616] - Human Muscle lysate, concentration 0.2-1 ug/ml.