CLN6 Antibody

Name CLN6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59646
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Sheep, Zebrafish
Antigen Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the middle region of CLN6. Peptide sequence LPRSITYVSIIIFIMGASIHLVGDSVNHRLLFSGYQHHLSVRENPIIKNL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CLN6
Supplier Page Shop

Product images