SLC6A15 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59653
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15) The peptide sequence was selected from the middle region of SLC6A15)(50ug). Peptide sequence YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKA
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC6A15
• Conjugate: Unconjugated