UGP2 Antibody

Name UGP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-55519
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UGP2(UDP-glucose pyrophosphorylase 2) The peptide sequence was selected from the N terminal of UGP2. Peptide sequence TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UGP2
Conjugate Unconjugated
Supplier Page Shop

Product images