REM1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55506
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to REM1(RAS (RAD and GEM)-like GTP-binding 1) Antibody(against the N terminal of REM1. Peptide sequence SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: REM1
• Conjugate: Unconjugated