KLHL32 Antibody

Name KLHL32 Antibody
Supplier Novus Biologicals
Catalog NBP1-56298
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KLHL32(kelch-like 32 (Drosophila)) The peptide sequence was selected from the middle region of KLHL32. Peptide sequence DVSREGKEEVFYGPTLPFASNGIAACFLPAPYFTCPNLQTLQVPHHRIGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KLHL32
Conjugate Unconjugated
Supplier Page Shop

Product images