LRRC17 Antibody
| Name | LRRC17 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55529 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LRRC17(leucine rich repeat containing 17) The peptide sequence was selected from the middle region of LRRC17. Peptide sequence YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRRC17 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14531_LRRC17-Antibody-Western-Blot-NBP1-55529-img0004.jpg)
Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Western Blot: LRRC17 Antibody [NBP1-55529] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14532_LRRC17-Antibody-Western-Blot-NBP1-55529-img0002.jpg)
Western Blot: LRRC17 Antibody [NBP1-55529] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.
![Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14533_LRRC17-Antibody-Western-Blot-NBP1-55529-img0003.jpg)
Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14534_LRRC17%2520Antibody-Western%2520Blot-NBP1-55529-img0005.jpg)
Western Blot: LRRC17 Antibody [NBP1-55529] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.