FAM78B Antibody

Name FAM78B Antibody
Supplier Novus Biologicals
Catalog NBP1-55527
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM78B(family with sequence similarity 78, member B) The peptide sequence was selected from the middle region of FAM78B. Peptide sequence PSVTWAVPVSDSNVPLLTRIKRDQSFTTWLVAMNTTTKEKIILQTIKWRM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM78B
Conjugate Unconjugated
Supplier Page Shop

Product images