FAM113A Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55521
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FAM113A(family with sequence similarity 113, member A) The peptide sequence was selected from the N terminal of FAM113A. Peptide sequence VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PCED1A
• Conjugate: Unconjugated