Name | Troponin T Type 3 (fast skeletal) Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56340 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptide directed towards the C terminal of human TNNT3 (NP_001036245). Peptide sequence QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | TNNT3 |
Supplier Page | Shop |