SEC23B Antibody
| Name | SEC23B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56339 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Horse, Zebrafish |
| Antigen | Synthetic peptides corresponding to SEC23B(Sec23 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of SEC23B. Peptide sequence SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SEC23B |
| Supplier Page | Shop |
Product images
![Western Blot: SEC23B Antibody [NBP1-56339] - Titration: 0.2-1 ug/ml, Positive Control: CCRF-CEM cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9287_SEC23B%2520Antibody-Western%2520Blot-NBP1-56339-img0003.jpg)
Western Blot: SEC23B Antibody [NBP1-56339] - Titration: 0.2-1 ug/ml, Positive Control: CCRF-CEM cell lysate.