PHYHIP Antibody

Name PHYHIP Antibody
Supplier Novus Biologicals
Catalog NBP1-56336
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PHYHIP(phytanoyl-CoA 2-hydroxylase interacting protein) The peptide sequence was selected from the N terminal of PHYHIP. Peptide sequence KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PHYHIP
Conjugate Unconjugated
Supplier Page Shop

Product images