Name | LRRC57 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56321 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to LRRC57(leucine rich repeat containing 57) The peptide sequence was selected from the N terminal of LRRC57. Peptide sequence MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LRRC57 |
Supplier Page | Shop |