KHDRBS2 Antibody

Name KHDRBS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56317
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KHDRBS2(KH domain containing, RNA binding, signal transduction associated 2) The peptide sequence was selected from the middle region of KHDRBS2. Peptide sequence EAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSE
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KHDRBS2
Conjugate Unconjugated
Supplier Page Shop

Product images