PPFIBP1 Antibody

Name PPFIBP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56315
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PPFIBP1(PTPRF interacting protein, binding protein 1 (liprin beta 1)) The peptide sequence was selected from the N terminal of PPFIBP1. Peptide sequence PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PPFIBP1
Conjugate Unconjugated
Supplier Page Shop

Product images