CDKL2 Antibody

Name CDKL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56376
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDKL2
Conjugate Unconjugated
Supplier Page Shop

Product images