Name | CDKL2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56376 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CDKL2(cyclin-dependent kinase-like 2 (CDC2-related kinase)) The peptide sequence was selected from the N terminal of CDKL2. Peptide sequence MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMR. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CDKL2 |
Conjugate | Unconjugated |
Supplier Page | Shop |