MORN4 Antibody

Name MORN4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56374
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C10ORF83 The peptide sequence was selected from the middle region of C10ORF83. Peptide sequence FGLLTFPDGSHGIPRNEGLFENNKLLRREKCSAIVQRAQSASKSARNLTA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MORN4
Conjugate Unconjugated
Supplier Page Shop

Product images