Name | UBXN1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56353 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to LOC51035(SAPK substrate protein 1) The peptide sequence was selected from the middle region of LOC51035. Peptide sequence RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | UBXN1 |
Conjugate | Unconjugated |
Supplier Page | Shop |