UBXN1 Antibody

Name UBXN1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56353
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LOC51035(SAPK substrate protein 1) The peptide sequence was selected from the middle region of LOC51035. Peptide sequence RIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UBXN1
Conjugate Unconjugated
Supplier Page Shop

Product images