TRUB2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56515
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TRUB2(TruB pseudouridine (psi) synthase homolog 2 (E. coli)) The peptide sequence was selected from the middle region of TRUB2. Peptide sequence MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: TRUB2
• Conjugate: Unconjugated