RAB40C Antibody

Name RAB40C Antibody
Supplier Novus Biologicals
Catalog NBP1-56513
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB40C(RAB40C, member RAS oncogene family) Antibody(against the N terminal of RAB40C. Peptide sequence QDGAAESPYAYSNGIDYKTTTILLDGRRVRLELWDTSGQGRFCTIFRSYS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB40C
Conjugate Unconjugated
Supplier Page Shop

Product images