LRRC49 Antibody

Name LRRC49 Antibody
Supplier Novus Biologicals
Catalog NBP1-56473
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRC49(leucine rich repeat containing 49) The peptide sequence was selected from the N terminal of LRRC49. Peptide sequence KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRC49
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.