Proline rich 16 Antibody
| Name | Proline rich 16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56472 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PRR16(proline rich 16) The peptide sequence was selected from the middle region of PRR16. Peptide sequence RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PRR16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Proline rich 16 Antibody [NBP1-56472] - Human Small Intestine, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17116_Proline%2520rich%252016%2520Antibody-Western%2520Blot-NBP1-56472-img0003.jpg)
Western Blot: Proline rich 16 Antibody [NBP1-56472] - Human Small Intestine, concentration 0.2-1 ug/ml.