ZADH2 Antibody

Name ZADH2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56464
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZADH2(zinc binding alcohol dehydrogenase domain containing 2) The peptide sequence was selected from the N terminal of ZADH2. Peptide sequence FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZADH2
Conjugate Unconjugated
Supplier Page Shop

Product images