Name | ZADH2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56464 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ZADH2(zinc binding alcohol dehydrogenase domain containing 2) The peptide sequence was selected from the N terminal of ZADH2. Peptide sequence FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ZADH2 |
Conjugate | Unconjugated |
Supplier Page | Shop |