TPD52 Antibody
| Name | TPD52 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56457 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TPD52(tumor protein D52) The peptide sequence was selected from the middle region of TPD52. Peptide sequence AGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TPD52 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TPD52 Antibody [NBP1-56457] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate TPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24202_TPD52-Antibody-Western-Blot-NBP1-56457-img0003.jpg)
Western Blot: TPD52 Antibody [NBP1-56457] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Jurkat cell lysate TPD52 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
![Immunohistochemistry: TPD52 Antibody [NBP1-56457] - Mouse retina Dilution: 1: 200 Secondary antibody: Goat anti-rabbit Alexafluor 568 Secondary antibody dilution: 1: 200 - See more at:](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24203_TPD52-Antibody-Immunohistochemistry-NBP1-56457-img0004.jpg)
Immunohistochemistry: TPD52 Antibody [NBP1-56457] - Mouse retina Dilution: 1: 200 Secondary antibody: Goat anti-rabbit Alexafluor 568 Secondary antibody dilution: 1: 200 - See more at: