VPS37C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56409
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to VPS37C(vacuolar protein sorting 37 homolog C (S. cerevisiae)) The peptide sequence was selected from the N terminal of VPS37C. Peptide sequence LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: VPS37C
• Conjugate: Unconjugated