Name | ACTR3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56406 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB IHC |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ACTR3 |
Conjugate | Unconjugated |
Supplier Page | Shop |