ACTR3 Antibody
| Name | ACTR3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56406 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ACTR3(ARP3 actin-related protein 3 homolog (yeast)) Antibody(against the N terminal of ACTR3 (NP_005712). Peptide sequence IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ACTR3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ACTR3 Antibody [NBP1-56406] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Lung](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24109_ACTR3%2520Antibody-Western%2520Blot-NBP1-56406-img0004.jpg)
Western Blot: ACTR3 Antibody [NBP1-56406] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Lung
![Immunohistochemistry: ACTR3 Antibody [NBP1-56406] - Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue Observed Staining: Cytoplasm in Leydig cells Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24110_ACTR3-Antibody-Immunohistochemistry-NBP1-56406-img0003.jpg)
Immunohistochemistry: ACTR3 Antibody [NBP1-56406] - Formalin Fixed Paraffin Embedded Tissue: Human Testis Tissue Observed Staining: Cytoplasm in Leydig cells Primary Antibody Concentration: 1:100 Other Working Concentrations: N/A Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec