EARS2 Antibody

Name EARS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56400
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EARS2(glutamyl-tRNA synthetase 2, mitochondrial (putative)) The peptide sequence was selected from the middle region of EARS2. Peptide sequence TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene EARS2
Conjugate Unconjugated
Supplier Page Shop

Product images