DNALI1 Antibody
| Name | DNALI1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56390 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DNALI1(dynein, axonemal, light intermediate chain 1) The peptide sequence was selected from the N terminal of DNALI1. Peptide sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DNALI1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNALI1 Antibody [NBP1-56390] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24209_DNALI1-Antibody-Western-Blot-NBP1-56390-img0002.jpg)
Western Blot: DNALI1 Antibody [NBP1-56390] - Transfected 293T cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: DNALI1 Antibody [NBP1-56390] - Application: IHCSpecies+tissue/cell type: Human nasal epithelial cells Primary Antibody dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 Secondary Antibody dilution: 1 : 1000 - See more at: //www. avivasysbio. com/dnali1- Anti](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24210_DNALI1%2520Antibody-Immunohistochemistry-NBP1-56390-img0003.jpg)
Immunohistochemistry: DNALI1 Antibody [NBP1-56390] - Application: IHCSpecies+tissue/cell type: Human nasal epithelial cells Primary Antibody dilution: 1 : 1000 Secondary Antibody: Goat anti-rabbit Alexa Fluor 546 Secondary Antibody dilution: 1 : 1000 - See more at: //www. avivasysbio. com/dnali1- Anti