DNALI1 Antibody

Name DNALI1 Antibody
Supplier Novus Biologicals
Catalog NBP1-56390
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human
Antigen Synthetic peptides corresponding to DNALI1(dynein, axonemal, light intermediate chain 1) The peptide sequence was selected from the N terminal of DNALI1. Peptide sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNALI1
Conjugate Unconjugated
Supplier Page Shop

Product images