MMD2 Antibody

Name MMD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-56388
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MMD2(monocyte to macrophage differentiation-associated 2) The peptide sequence was selected from the N terminal of MMD2. Peptide sequence FAPRLLDFQKTKYARFMNHRVPAHKRYQPTEYEHAANCATHAFWIIPSIL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MMD2
Conjugate Unconjugated
Supplier Page Shop

Product images