WDR55 Antibody

Name WDR55 Antibody
Supplier Novus Biologicals
Catalog NBP1-56385
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WDR55(WD repeat domain 55) The peptide sequence was selected from the middle region of WDR55. Peptide sequence AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WDR55
Conjugate Unconjugated
Supplier Page Shop

Product images