ALAD Antibody
| Name | ALAD Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56507 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Bovine, Dog, Guinea Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to ALAD(aminolevulinate, delta-, dehydratase) The peptide sequence was selected from the N terminal of ALAD. Peptide sequence EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ALAD |
| Supplier Page | Shop |
Product images
![Western Blot: ALAD Antibody [NBP1-56507] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/9337_ALAD%2520Antibody-Western%2520Blot-NBP1-56507-img0002.jpg)
Western Blot: ALAD Antibody [NBP1-56507] - Jurkat cell lysate, concentration 0.2-1 ug/ml.