NOC3L Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56497
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NOC3L(nucleolar complex associated 3 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOC3L. Peptide sequence TLKKYRKEQRKLRQAVKDAVSKKPIPLENPKEKRPGKRIEREEEEEEEAL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: NOC3L
• Conjugate: Unconjugated